PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G168800.1.p
Common NameSETIT_030441mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 354aa    MW: 37990.5 Da    PI: 6.1333
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G168800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.8e-33134188155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprlrWt +LHerFv+av+qLGG+ekAtPktil++m+vkgLtl h+kSHLQkYRl
  Seita.2G168800.1.p 134 KPRLRWTADLHERFVDAVAQLGGPEKATPKTILRTMGVKGLTLFHLKSHLQKYRL 188
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.738131191IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-31131189IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-24134189IPR006447Myb domain, plants
SuperFamilySSF466893.4E-16134190IPR009057Homeodomain-like
PfamPF002492.6E-8136187IPR001005SANT/Myb domain
PfamPF143791.4E-20229275IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MALLTNQIFK SHEEGGERER EQGGREESLP VESGRSSREA RTSKKGERES RGTFPWIGSF  60
AFAAEEGGEE GPVSPLSAAA ESSRSQEGAE EEEMFPPGLI HHRPDGPAPG DGAPRSGPGG  120
GPGGPSLVLT ADPKPRLRWT ADLHERFVDA VAQLGGPEKA TPKTILRTMG VKGLTLFHLK  180
SHLQKYRLGK QSGKEGSEQS KDASYLLDAQ SGMSVSPRVA AQDVKESQEV KEALRAQMEV  240
QRRLHEQVEV QKRVQIRMEA LQKYIDSILE SACKMVTEQF ASSGFSISDP DLPEISPGGV  300
MCGPTDTLSS SVFNQLSVSS IDSHSPGGKP SPSGIEGPPM LLQKSPELKR RSS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956514.10.0PREDICTED: myb family transcription factor APL-like isoform X1
TrEMBLK3ZV100.0K3ZV10_SETIT; Uncharacterized protein
STRINGSi030441m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34273873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-72G2-like family protein